missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. ADCK4 Antibody, Novus Biologicals™

ADCK4 Antibody, Novus Biologicals™

Product Code. 18229746 Shop All Bio Techne Products
Change view
Click to view available options
Quantité:
25 μL
0.1 mL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité Unit Size
18229746 0.1 mL 0.10mL
18467091 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18229746 Supplier Novus Biologicals Supplier No. NBP185508
  • ONLINE EXCLUSIVE PRICE
    626.08€
    540.75€ / 0.1mL
    Save 85.33€
    13% Off
 Article restreint
Estimated Shipment: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ADCK4 Polyclonal specifically detects ADCK4 in Human, Mouse, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigène ADCK4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène aarF domain containing kinase 4, COQ8, EC 2.7.11, EC 2.7.11.-, EC 2.7.11.1, EC 2.7.11.25, FLJ12229
Symboles de gène(s) COQ8B
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:RQSADFMPRWQMLRVLEEELGRDWQAKVASLEEVPFAAASIGQVHQGLLRDGTEVAVKIQY
Méthode de purification Affinity Purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Protein Kinase
Primaire ou secondaire Primary
Identification génétique (Entrez) 79934
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human, Mouse, Rat
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.