missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. CD8 Antibody (CL1529), R&D Systems™

CD8 Antibody (CL1529), R&D Systems™

Code produit 18608625 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
25 μL
0.1 mL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Quantité Tamaño de la unidad
18608625 25 μL 25µL
18173519 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18608625 Proveedor Novus Biologicals N.º de proveedor NBP23674325ul
 Article restreint
Estimated Shipment: 01-12-2026
Añadir a la cesta
Añadir a la cesta

missing translation for 'validMainframeMsg'

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

A Novus product, part of R&D Systems. Mouse Monoclonal Antibody

CD8 Monoclonal specifically detects CD8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Especificaciones

Antigène CD8
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL1529
Conjugué Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Numéro d’ordre du gène P01732
Alias de gène CD8, CD8a molecule, LEU2, p32
Symboles de gène(s) CD8A
Espèces hôtes Mouse
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:AASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPT
Méthode de purification Protein A purified
Quantité 25 μL
État réglementaire RUO
Disciplines de recherche Innate Immunity
Primaire ou secondaire Primary
Identification génétique (Entrez) 925
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reconstitution Protein A purified
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Forme Purified
Isotype IgG1
Mostrar más Mostrar menos

For Research Use Only

Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.