missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 16108292

FGF21, Mouse, Clone: 1A8, Abnova™

Code produit 16108292
Modifier l'affichage
Click to view available options
Quantité:
100 μg
Conditionnement:
100µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
16108292 100 μg 100µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16108292 Fournisseur Abnova Code fournisseur H00026291M02.100ug
 Article restreint
Estimated Shipment: 07-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Mouse monoclonal antibody raised against a full-length recombinant FGF21.

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. [provided by RefSeq

Sequence: PIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAPPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Spécification

Antigène FGF21
Applications ELISA, Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1A8
Conjugué Unconjugated
Description Mouse monoclonal antibody raised against a full length recombinant FGF21.
Formule PBS with no preservative; pH 7.4
Expression FGF21
Numéro d’ordre du gène BC018404
Symboles de gène(s) FGF21
Espèces hôtes Mouse
Immunogène FGF21 (AAH18404, 30 a.a. ∼ 209 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Méthode de purification Unpurified
Quantité 100 μg
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 26291
Espèces cibles Human
Contenu et stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Type de produit Antibody
Isotype IgG1 κ
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.