missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. 16188494

GAPDH, Mouse, Polyclonal Antibody, Abnova™

Code produit 16188494
Modifier l'affichage
Click to view available options
Quantité:
50 μL
Conditionnement:
50µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
16188494 50 μL 50µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 16188494 Fournisseur Abnova Code fournisseur H00002597A01.50uL
 Article restreint
Estimated Shipment: 07-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Mouse polyclonal antibody raised against a partial recombinant GAPDH.

The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome. [provided by RefSeq

Sequence: GKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Spécification

Antigène GAPDH
Applications ELISA, Western Blot
Classification Polyclonal
Conjugué Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant GAPDH.
Formule 50% glycerol
Expression GAPDH
Numéro d’ordre du gène NM_002046
Alias de gène G3PD/GAPD/MGC88685
Symboles de gène(s) GAPDH
Espèces hôtes Mouse
Immunogène GAPDH (NP_002037, 226 a.a. ∼ 335 a.a) partial recombinant protein with GST tag.
Quantité 50 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 2597
Espèces cibles Human
Contenu et stockage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Type de produit Antibody
Forme Liquid
Isotype IgG
Afficher plus Afficher moins
Nom du produit
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.