missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ C19orf10 Recombinant Protein (P02)
Brand: Abnova™ H00056005-P02.10ug
Additional Details : Weight : 0.00010kg
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH10129 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
41.36 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
10 ug | |
VSEPTTVAFDVRPGGVVHSFFHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL | |
EUROIMAGE1875335/IL25/IL27/IL27w/R33729_1/SF20 | |
C19orf10 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
56005 | |
C19orf10 (Human) Recombinant Protein (P02) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
C19orf10 | |
Human | |
Recombinant | |
Solution |