missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. Complement C4a Antibody, Novus Biologicals™

Complement C4a Antibody, Novus Biologicals™

Code produit 18603806 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
25 μL
0.1 mL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
18603806 0.1 mL 0.10mL
18697435 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18603806 Fournisseur Novus Biologicals Code fournisseur NBP246783
  • ONLINE EXCLUSIVE PRICE
    593.50€
    560.70€ / 0.1mL
    Save 32.80€
    5% Off
 Article restreint
Estimated Shipment: 02-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

Complement C4a Polyclonal antibody specifically detects Complement C4a in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Spécification

Antigène Complement C4a
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Formule PBS (pH 7.2), 40% Glycerol
Numéro d’ordre du gène P0C0L5
Alias de gène C3 and PZP-like alpha-2-macroglobulin domain-containing protein 2, C4, complement component 4A (Rodgers blood group), RG
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids: LHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYG
Méthode de purification Immunogen affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Immunology, Innate Immunity
Primaire ou secondaire Primary
Identification génétique (Entrez) 720
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Forme Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.