missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. SLU7 Antibody, R&D Systems™

SLU7 Antibody, R&D Systems™

Product Code. 18602807 Shop All Bio Techne Products
Change view
Click to view available options
Quantité:
25 μL
100 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantité Unit Size
18602807 25 μL 25µL
18200165 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18602807 Supplier Novus Biologicals Supplier No. NBP25866525ul
  • ONLINE EXCLUSIVE PRICE
    457.09€
    391.65€ / 25µL
    Save 65.44€
    14% Off
 Article restreint
Estimated Shipment: 02-12-2026
Add to basket
Add to basket

missing translation for 'validMainframeMsg'

This item is not returnable. View return policy

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLU7 Polyclonal specifically detects SLU7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
TRUSTED_SUSTAINABILITY

Specifications

Antigène SLU7
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formule PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Alias de gène hSlu7, MGC9280, pre-mRNA-splicing factor SLU7,9G8, SLU7 splicing factor homolog (S. cerevisiae), splicing factor, step II splicing factor SLU7, zinc knuckle motif containing
Symboles de gène(s) SLU7
Espèces hôtes Rabbit
Immunogène This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YSRHGTVIKGQERAVACSKYEEDVKIHNHTHIWGSYWKEGRWGYKCCHSFFKYSYCTGEAGKEIVNSEECIINEITGEESVKKPQTLMELHQ
Méthode de purification Affinity Purified
Quantité 25 μL
État réglementaire RUO
Primaire ou secondaire Primary
Identification génétique (Entrez) 10569
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Type de produit Antibody
Isotype IgG
Gamme de produits Novus
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.