missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GMPS. Source: E.coli Amino Acid Sequence: AGGDLKDGHHHYEGAVVILDAGAQYGKVIDRRVRELFVQSEIFPLETPAFAIKEQGFRAIIISGGPNSVYAEDAPWFDPAIFTIGKPVLGICYGMQMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLT The GMPS Recombinant Protein Antigen is derived from E. coli. The GMPS Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications
Specifications
| Gene ID (Entrez) | 8833 |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | GMPS Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles. |
| Formulation | PBS and 1M Urea, pH 7.4. |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein |
| Gene Symbol | GMPS |
| Label Type | Unlabeled |
| Product Type | Recombinant Protein Antigen |
| Show More |
For Research Use Only.
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?