missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197827

Invitrogen™ Human ADAM12 (aa 737-805) Control Fragment Recombinant Protein

Product Code. 30197827
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197827

Brand: Invitrogen™ RP94992

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83163 (PA5-83163. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ADAM12 is a member of the ADAM (a disintegrin and metalloprotease-like domain) family. Two forms of ADAM12 have been described: ADAM12S and ADAM12L (short and long forms). The short form is a soluble form lacking the transmembrane and cytoplasmic domains. The short form of ADAM12 was reported to provoke myogenesis, and the lack of cytoplasmic domain suggests different regulation pathways (although both forms can be expressed in the same tissue).
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O43184
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8038
Name Human ADAM12 (aa 737-805) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias a disintegrin and metallopeptidase domain 12 (meltrin alpha); a disintegrin and metalloprotease domain 12; a disintegrin and metalloproteinase; a disintegrin and metalloproteinase domain 12 (meltrin alpha); ADAM; ADAM 12; ADAM metallopeptidase domain 12; Adam12; ADAM12-OT1; ADAMs; CAR10; Disintegrin and metalloproteinase domain-containing protein 12; MCMP; MCMPMltna; meltrin alpha; meltrin-alpha; metalloendopeptidases; metalloprotease-disintegrin 12 transmembrane; mKIAA4001; MLTN; Mltna; PRO545; RP11-295J3.5; UNQ346; UNQ346/PRO545
Common Name ADAM12
Gene Symbol ADAM12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LLFTNKKTTIEKLRCVRPSRPPRGFQPCQAHLGHLGKGLMRKPPDSYPPKDNPRRLLQCQNVDISRPLN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.