missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213095

Invitrogen™ Human ARAP1 (aa 304-408) Control Fragment Recombinant Protein

Product Code. 30213095
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213095

Brand: Invitrogen™ RP105502

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67101 (PA5-67101. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ARAP1 (angiotensin II type 1 receptor-associated protein) is an adaptor protein with ArfGAP and RhoGAP activities, containing five PH domains and ankyrin repeat. This adaptor seems to serve as a link between phosphoinositide- Arf-, and Rho-mediated cell signaling. ARAP1 supports the plasma membrane recycling of angiotensin II type 1 receptor (AT1) and is important also for cell-specific trafficking of pro-death receptor TRAIL-R1 (DR4) to the plasma membrane, thus promoting the TRAIL-induced apoptosis in certain cell types. ARAP1 also affects cell spreading.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96P48
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 116985
Name Human ARAP1 (aa 304-408) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410002L19Rik; arap1; Arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1; ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1; ARF-GAP, RHO-GAP, ankyrin repeat, and pleckstrin homology domains-containing protein 1; centaurin, delta 2; centaurin-delta-2; Centd2; cnt-d2; Kiaa0782; mKIAA0782
Common Name ARAP1
Gene Symbol Arap1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.