missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213145

Invitrogen™ Human ATP6V1A (aa 20-113) Control Fragment Recombinant Protein

Product Code. 30213145
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213145

Brand: Invitrogen™ RP104654

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65138 (PA5-65138. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ATP6V1A encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of two V1 domain A subunit isoforms and is found in all tissues. Transcript variants derived from alternative polyadenylation exist.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P38606
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 523
Name Human ATP6V1A (aa 20-113) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 70-kDa subunit; AI647066; Atp6a1; Atp6a2; Atp6v1a; Atp6v1a1; ATPase H+ transporting V1 subunit A; ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha 70 kDa, isoform 2; ATPase, H+ transporting, lysosomal 70 kD, V1 subunit A, isoform 1; ATPase, H+ transporting, lysosomal 70 kDa, V1 subunit A; ATPase, H+ transporting, lysosomal V1 subunit A; ATPase, H+ transporting, lysosomal, subunit A1; ATPase, H+ transporting, V1 subunit A, isoform 1; ATPase, H+ transporting, V1 subunit A1; H(+)-transporting two-sector ATPase, subunit A; H+-transporting ATPase chain A, vacuolar (VA68 type); HO68; lysosomal 70 kDa; VA68; vacuolar ATP synthase catalytic subunit A, ubiquitous isoform; vacuolar ATPase isoform VA68; vacuolar proton pump alpha subunit 1; vacuolar proton pump subunit alpha; V-ATPase 69 kDa subunit; V-ATPase 69 kDa subunit 1; V-ATPase A subunit 1; V-ATPase subunit A; Vma1; VPP2; V-type proton ATPase catalytic subunit A
Common Name ATP6V1A
Gene Symbol ATP6V1A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.