missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human COLQ (aa 287-369) Control Fragment Recombinant Protein

Product Code. 30203691
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203691

Brand: Invitrogen™ RP106100

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65418 (PA5-65418. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

COLQ (collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase), also known as EAD, is a 455 amino acid protein that localizes to the end plate of skeletal muscle. COLQ anchors the catalytic subunits of asymmetric AChE (acetylcholinesterase) to the basal lamina at the neuromuscular junctions of vertebrates. Mutations of COLQ lead to congenital myasthenic syndromes which are rare autosomal recessive diseases characterized by general weakness increased by exertion, ophthalmoplegia and refractoriness to anticholinesterase drugs. Eight isoforms exist due to alternative splicing events.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9Y215
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8292
Name Human COLQ (aa 287-369) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A130034K24Rik; acetylcholinesterase collagenic tail peptide; Acetylcholinesterase-associated collagen; AChE Q subunit; CMS5; collagen like tail subunit of asymmetric acetylcholinesterase; collagenic tail of endplate acetylcholinesterase; collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase; collagen-like tail subunit of asymmetric acetylcholinesterase; Colq; EAD; single strand of homotrimeric collagen-like tail subunit of asymmetric acetylcholinesterase
Common Name COLQ
Gene Symbol COLQ
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PPGRCLCGPTMNVNNPSYGESVYGPSSPRVPVIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQLTPFYPVDYTA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.