missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30193768

Invitrogen™ Human EBLN2 (aa 7-65) Control Fragment Recombinant Protein

Product Code. 30193768
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30193768

Brand: Invitrogen™ RP104020

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (25%), Rat (25%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64385 (PA5-64385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May act as an RNA-binding protein. The C-terminal region is highly homologous to the bornavirus nucleocapsid N protein that binds viral RNA and oligomerizes. The viral protein also possesses a nuclear import and a nuclear export signal. These 2 signals seem absent in EBLN-2 supporting an unrelated function in Human.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6P2I7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55096
Name Human EBLN2 (aa 7-65) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias EBLN-1; EBLN2; EBLN-2; endogenous Borna-like N element-1; endogenous Borna-like N element-2; Endogenous Bornavirus-like nucleoprotein 2; GK006; ikappaBalpha; I-kappa-B-alpha; Ikba; ikB-alpha; Inhibitor of nuclear factor of kappa light chain gene enhancer in B-cells alpha; Inhibitor of nuclear factor of kappa light chain gene enhancer in B-cells, alpha; NF-kappa-B inhibitor alpha; Nfkbia; nuclear factor of kappa light chain gene enhancer in B-cells inhibitor, alpha; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha; RL/IF-1
Common Name EBLN2
Gene Symbol EBLN2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LYAYVNSHSLFVWVCDRSYKRSFRPMILNKIKELSRNQFSTMSHLRKDSQPSSPGDDAM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.