missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209939

Invitrogen™ Human GLRA4 Control Fragment Recombinant Protein

Product Code. 30209939
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209939

Brand: Invitrogen™ RP100486

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60817 (PA5-60817. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Glra4 is a member of glycine receptors (GlyR), a cys-loop family of ligand-gated ion channels responsible for mediating the inhibitory effects of glycine. GlyR are widely distributed throughout the CNS, particularly within the hippocampus, spinal cord and brain stem. Glycine receptors are ligand-gated chloride channels. Channel opening is triggered by extracellular glycine and channel opening is also triggered by taurine and beta-alanine. Glra4 plays a role in the down-regulation of neuronal excitability, and contributes to the generation of inhibitory postsynaptic currents. The Glra4 gene encodes a protein which has a neurotransmitter-gated ion-channel ligand binding domain. Glra4 protein is very similar to a mouse protein which is a subunit of the retinal glycine receptor. Multiple transcript variants encoding different isoforms have been found for the Glra4 gene. Diseases associated with GLRA4 include Pelizaeus-Merzbacher Disease.
TRUSTED_SUSTAINABILITY

Specifications

Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 441509
Name Human GLRA4 Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Glra4; glycine receptor alpha 4; glycine receptor subunit alpha-4; glycine receptor, alpha 4; glycine receptor, alpha 4 subunit; RGD1564103
Common Name GLRA4
Gene Symbol GLRA4
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IRLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGGPMEGSGIYSPQPPAPLLREGETTRKLYVD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.