missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GTF3C2 (aa 810-905) Control Fragment Recombinant Protein

Product Code. 30211272
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30211272

Brand: Invitrogen™ RP96554

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57418 (PA5-57418. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Required for RNA polymerase III-mediated transcription. Component of TFIIIC that initiates transcription complex assembly on tRNA and is required for transcription of 5S rRNA and other stable nuclear and cytoplasmic RNAs. May play a direct role in stabilizing interactions of TFIIIC2 with TFIIIC1. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8WUA4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2976
Name Human GTF3C2 (aa 810-905) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1300004C11Rik; 2610510G03Rik; AI225816; AU041069; general transcription factor 3 C polypeptide 2; general transcription factor IIIC subunit 2; general transcription factor IIIC, polypeptide 2, beta; general transcription factor IIIC, polypeptide 2, beta 110 kDa; Gtf3c2; KIAA0011; mKIAA0011; TF3C-beta; TFIIIC 110 kDa subunit; TFIIIC110; TFIIIC-BETA; Transcription factor IIIC 110 kDa subunit; transcription factor IIIC subunit beta
Common Name GTF3C2
Gene Symbol GTF3C2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LRREPMLRMQEGEGHSQLCLDRLQLEAIHKVRFSPNLDSYGWLVSGGQSGLVRIHFVRGLASPLGHRMQLESRAHFNAMFQPSSPTRRPGFSPTSH
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.