missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198582

Invitrogen™ Human HID1 (aa 668-755) Control Fragment Recombinant Protein

Product Code. 30198582
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198582

Brand: Invitrogen™ RP93390

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54695 (PA5-54695. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May play an important role in the development of cancers in a broad range of tissues. [UniProt]
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8IV36
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 283987
Name Human HID1 (aa 668-755) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias C17orf28; C630004H02Rik; C9H17orf28; DMC1; downregulated in multiple cancer 1; Down-regulated in multiple cancers 1; Hid1; HID-1; HID1 domain containing; HID1 domain-containing protein; protein HID1; Protein hid-1 homolog; RGD1311422; UPF0663 transmembrane protein C17orf28; UPF0663 transmembrane protein C17orf28 homolog
Common Name HID1
Gene Symbol HID1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RPSTSSASGQWSPTPEWVLSWKSKLPLQTIMRLLQVLVPQVEKICIDKGLTDESEILRFLQHGTLVGLLPVPHPILIRKYQANSGTAM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis