missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human HLA-DMB (aa 141-211) Control Fragment Recombinant Protein

Product Code. 30209554
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209554

Brand: Invitrogen™ RP109633

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139954 (PA5-139954. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DMB (major histocompatibility complex, class II, DM beta), also known as D6S221E, RING7, HLA-DM histocompatibility type, beta chain, HLADMB or RING7, is a protein that in humans is encoded by the HLA-DMB gene. The HLA-DMB gene is mapped on 6p21.32. HLA-DMB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DMA) and a beta (DMB) chain, both anchored in the membrane. It is located in intracellular vesicles. DM plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP (class II-associated invariant chain peptide) molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells. The beta chain is approximately 26-28 kDa and its gene contains 6 exons. HLA-DMA and -DMB appear to encode subunits of a functional heterodimer that is critical in the pathway of class II antigen presentation. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P28068
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 3109
Name Human HLA-DMB (aa 141-211) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias class II histocompatibility antigen, M beta chain; D6S221E; DAAP-27A1.4; DMB; HLA class II histocompatibility antigen, DM beta chain; HLA-DMB; major histocompatibility complex, class II, DM beta; MHC class II antigen DMB; MHC class II antigen HLA-DM beta chain; MHC class II HLA-DMB; really interesting new gene 7 protein; RING7
Common Name HLA-DMB
Gene Symbol HLA-DMB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHTGAPEPILRDWTPGL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.