missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30180647

Invitrogen™ Human Kindlin (aa 359-415) Control Fragment Recombinant Protein

Product Code. 30180647
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30180647

Brand: Invitrogen™ RP98362

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Kindlin 1 is a member of the kindlin family of focal adhesion proteins and contains a FERM domain and pleckstrin homology domain. It is involved in integrin signaling, linkage of the cytoskeleton to the extracellular matrix, and cell adhesion. It is most often expressed in epithelial cells. When kindlin 1 is coexpressed with talin it helps to activate ITGA2B. It is required for keratinocyte proliferation, polarization of basal keratinocytes in the skin, and for normal cell shape. Mutations in kindlin 1 have been linked to Kindler syndrome, a recessive skin disorder involving blistering, photosensitivity, poikiloderma, and atrophy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BQL6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55612
Name Human Kindlin (aa 359-415) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5830467P10Rik; C20orf42; DTGCU2; Fermitin family homolog 1; fermitin family homolog 1 (Drosophila); fermitin family member 1; FERMT1; FLJ20116; FLJ23423; KIND1; Kindlerin; kindlin 1; kindlin syndrome protein; Kindlin-1; RGD1306816; RP5-1056H1.1; UNC112 related protein 1; UNC-112 related protein 1; UNC112A; unc-112-related protein 1; URP1
Common Name Kindlin
Gene Symbol FERMT1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ADSLLEDITDIPKLADNLKLFRPKKLLPKAFKQYWFIFKDTSIAYFKNKELEQGEPL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.