missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210971

Invitrogen™ Human LTB4R (aa 297-350) Control Fragment Recombinant Protein

Product Code. 30210971
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210971

Brand: Invitrogen™ RP89140

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (61%), Rat (61%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

LTB4R (Leukotriene B4 Receptor) is a member of the GPCR family. It is a receptor for leukotriene B4, a potent chemoattractant involved in inflammation and immune response. It has been reported in blood, bone marrow, brain, heart, liver, and skeletal muscle. In addition, it has been shown to be highly expressed in leukocytes and lymphoid tissues such as spleen, thymus, and lymph node. ESTs have been isolated from B-cell/lung/testis, breast, colon, eye, kidney, skin, spleen, testis, and tonsil libraries.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15722
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1241
Name Human LTB4R (aa 297-350) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias BLT; BLT1; BLT-1; BLTR; Chemoattractant receptor-like 1; chemokine receptor-like 1; CMKRL1; G protein-coupled receptor 16; GPR16; G-protein coupled receptor 16; leukotriene B4 receptor; leukotriene B4 receptor 1; LTB4 receptor; Ltb4r; LTB4-R 1; Ltb4r1; LTB4-R1; LTBR1; mBLTR; P2RY7; P2Y purinoceptor 7; P2Y7; purinergic receptor P2Y, G-protein coupled, 7
Common Name LTB4R
Gene Symbol LTB4R
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.