missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30209764

Invitrogen™ Human Mast Cell Chymase (aa 150-203) Control Fragment Recombinant Protein

Product Code. 30209764
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30209764

Brand: Invitrogen™ RP101142

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84117 (PA5-84117. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene product is a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Angiotensin II has been implicated in blood pressure control and in the pathogenesis of hypertension, cardiac hypertrophy, and heart failure. Thus, this gene product is a target for cardiovascular disease therapies. This gene maps to 14q11. 2 in a cluster of genes encoding other proteases.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P23946
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 1215
Name Human Mast Cell Chymase (aa 150-203) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias alpha-chymase; Chymase; chymase 1; chymase 1 preproprotein transcript E; chymase 1 preproprotein transcript I; chymase 1, mast cell; chymase, heart; chymase, mast cell; CMA1; CYH; CYM; mast cell; Mast cell chymase 1; mast cell protease 3; Mast cell protease 5; mast cell protease I; Mast cell protease III; MCP3P; Mcp5; Mcp-5; Mcpt3; Mcpt5; MCT1; mMCP-5; rMCP-3; rMCP-5; rMCP-III
Common Name Mast Cell Chymase
Gene Symbol CMA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.