missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30208771

Invitrogen™ Human NSE2 (aa 163-241) Control Fragment Recombinant Protein

Product Code. 30208771
Click to view available options
Quantity:
100 μL
Förpackningsstorlek
100µL
Denna artikel kan inte returneras. Se returpolicy

Produktkod. 30208771

missing translation for 'mfr': Invitrogen™ RP104928

Please to purchase this item. Need a web account? Register with us today!

Denna artikel kan inte returneras. Se returpolicy

Beskrivning

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65676 (PA5-65676. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the large subunit of DNA damage-binding protein which is a heterodimer composed of a large and a small subunit. This protein functions in nucleotide-excision repair. Its defective activity causes the repair defect in the patients with xeroderma pigmentosum complementation group E (XPE). However, it remains for mutation analysis to demonstrate whether the defect in XPE patients is in this gene or the gene encoding the small subunit. In addition, Best vitelliform mascular dystrophy is mapped to the same region as this gene on 11q, but no sequence alternations of this gene are demonstrated in Best disease patients.
TRUSTED_SUSTAINABILITY

Specifikationer

Accession Number Q96MF7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 286053
Name Human NSE2 (aa 163-241) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110014D18Rik; AI661537; C8orf36; E3 SUMO-protein ligase NSE2; E3 SUMO-protein transferase NSE2; FLJ32440; hMMS21; methyl methanesulfonate sensitivity gene 21; MMS21; MMS21 homolog; non-SMC element 2 homolog; non-SMC element 2 homolog (MMS21, S. cerevisiae); non-SMC element 2, MMS21 homolog; non-SMC element 2, MMS21 homolog (S. cerevisiae); non-structural maintenance of chromosomes element 2 homolog; NSE2; NSE2 (MMS21) homolog, SMC5-SMC6 complex SUMO ligase; NSE2/MMS21 homolog, SMC5-SMC6 complex SUMO ligase; NSMCE2; RGD1305156; Unknown (protein for MGC:133996); zinc finger, MIZ-type containing 7; ZMIZ7
Common Name NSE2
Gene Symbol Nsmce2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SQTNFTCPITKEEMKKPVKNKVCGHTYEEDAIVRMIESRQKRKKKAYCPQIGCSHTDIRKSDLIQDEALRRAIENHNKK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.