missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30196734

Invitrogen™ Human NSP5 (aa 221-296) Control Fragment Recombinant Protein

Product Code. 30196734
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30196734

Brand: Invitrogen™ RP93235

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54404 (PA5-54404. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the cytospin-A family. It is localized in the nucleus, and highly expressed in testis and some cancer cell lines. A chromosomal translocation involving this gene and platelet-derived growth factor receptor, beta gene (PDGFRB) may be a cause of juvenile myelomonocytic leukemia. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5M775
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 92521
Name Human NSP5 (aa 221-296) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2810012G08Rik; B230396K10Rik; cytokinesis and spindle organization B; cytospin B; cytospin-B; CYTSB; HCMOGT1; HCMOGT-1; NSP; NSP5; NSP5a3a; NSP5alpha3alpha; Nuclear structure protein 5; RGD1309718; SPECC1; spectrin domain with coiled-coils 1; sperm antigen HCMOGT-1; Sperm antigen with calponin homology and coiled-coil domains 1; sperm antigen with calponin-like and coiled coil domains 1; structure protein NSP5a3a; structure protein NSP5a3b; structure protein NSP5b3a; structure protein NSP5b3b
Common Name NSP5
Gene Symbol Specc1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DTEPMIRALEEKNKNFQKELSDLEEENRVLKEKLIYLEHSPNSEGAASHTGDSSCPTSITQESSFGSPTGNQMSSD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.