missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human PDSS1 (aa 319-412) Control Fragment Recombinant Protein

Product Code. 30194628
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194628

Brand: Invitrogen™ RP97102

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58217 (PA5-58217. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PDSS1 is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. PDSS1 catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in PDSS1 gene are a cause of coenzyme Q10 deficiency.The protein encoded by this gene is an enzyme that elongates the prenyl side-chain of coenzyme Q, or ubiquinone, one of the key elements in the respiratory chain. The gene product catalyzes the formation of all trans-polyprenyl pyrophosphates from isopentyl diphosphate in the assembly of polyisoprenoid side chains, the first step in coenzyme Q biosynthesis. The protein may be peripherally associated with the inner mitochondrial membrane, though no transit peptide has been definitively identified to date. Defects in this gene are a cause of coenzyme Q10 deficiency.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q5T2R2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23590
Name Human PDSS1 (aa 319-412) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610203G20Rik; 2700031G06Rik; All-trans-decaprenyl-diphosphate synthase subunit 1; COenzyme Q (ubiquinone) biosynthesis family member (coq-1)-like; coenzyme Q1 homolog; COQ1; COQ10D2; decaprenyl diphdsphate synthase subunit1; decaprenyl diphosphate synthase subunit 1; decaprenyl pyrophosphate synthase subunit 1; decaprenyl pyrophosphate synthetase subunit 1; decaprenyl-diphosphate synthase subunit 1; DPS; Dps1; hDPS1; hypothetical protein LOC550349; LOW QUALITY PROTEIN: decaprenyl-diphosphate synthase subunit 1; mDLP1; MGC70953; mSPS1; PDSS1; polyprenyl pyrophosphate synthetase; prenyl (decaprenyl) diphosphate synthase, subunit 1; prenyl (solanesyl) diphosphate synthase, subunit 1; prenyl diphosphate synthase, subunit 1; RP13-16H11.3; solanesyl-diphosphate synthase subunit 1; SPS; Sps1; subunit 1 of decaprenyl diphosphate synthase; subunit 1 of solanesyl diphosphate synthase; TPRT; TPT; TPT 1; trans-prenyltransferase; trans-prenyltransferase (TPT); trans-prenyltransferase 1; wu:fc11f12; wu:fd05d05; zgc:112058
Common Name PDSS1
Gene Symbol PDSS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.