missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30210353

Invitrogen™ Human PI4KA (aa 1858-1925) Control Fragment Recombinant Protein

Product Code. 30210353
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30210353

Brand: Invitrogen™ RP108050

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67389 (PA5-67389. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PI4KB and PI4KA are the two human type III PI4 kinases, which share sequence similarly with PI3 kinases and phosphorylate the 4 position of phosphotidyl inositol. The mammalian PI 4-kinases have been classified into two types, II and III, based on their molecular mass, and modulation by detergent and adenosine. The protein encoded by PI4KA is a type III enzyme that is not inhibited by adenosine. Two transcript variants encoding different isoforms have been described for PI4KA.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P42356
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5297
Name Human PI4KA (aa 1858-1925) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias leuserpin 2; phosphatidylinositol 4-kinase; phosphatidylinositol 4-kinase 230; phosphatidylinositol 4-kinase a; phosphatidylinositol 4-kinase alpha; phosphatidylinositol 4-kinase, catalytic, alpha; phosphatidylinositol 4-kinase, catalytic, alpha polypeptide; phosphatidylinositol 4-kinase, type III, alpha; pi4K230; Pi4ka; PI4K-ALPHA; PI4-kinase alpha; Pik4; PIK4CA; PMGYCHA; ptdIns-4-kinase alpha; testicular secretory protein Li 35
Common Name PI4KA
Gene Symbol PI4KA
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.