missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30212410

Invitrogen™ Human SCUBE2 (aa 625-728) Control Fragment Recombinant Protein

Product Code. 30212410
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30212410

Brand: Invitrogen™ RP88797

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52283 (PA5-52283. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SCUBE2 is a member of a family of secreted glycoproteins that contain N-terminal EGF-like repeats and C-terminal cysteine-rich motifs and CUB domain and are expressed in embryonic neuroectoderm and vascular epithelium. SCUBE2 is a close homolog to SCUBE1 and can form a heterodimeric complex with SCUBE1. SCUBE2 is thought to participate in the Hedgehog signaling pathway by specifically interacting with Sonic Hedgehog (SHH) and the receptor PTCH1, enhancing the SHH signaling activity in the raft microdomains of the plasma membrane, and may thus play important roles in organ development and tumor progression.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NQ36
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57758
Name Human SCUBE2 (aa 625-728) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CEGB1; CEGF1; CEGP1; Protein CEGP1; RGD1563998; Scube/You; SCUBE2; Scube2-ps1; signal peptide; Signal peptide, CUB and EGF-like domain-containing protein 2; signal peptide, CUB domain and EGF like domain containing 2; signal peptide, CUB domain, EGF-like 2; signal peptide, CUB domain, EGF-like 2, pseudogene 1
Common Name SCUBE2
Gene Symbol SCUBE2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ESCGVGQGHAENQCVSCRAGTYYDGARERCILCPNGTFQNEEGQMTCEPCPRPGNSGALKTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQPEAGRTSC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.