missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human SFRS8 (aa 200-290) Control Fragment Recombinant Protein

Product Code. 30181747
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30181747

Brand: Invitrogen™ RP97659

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59050 (PA5-59050. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Signal-induced proliferation associated-like protein 2 (SIPA1L2) is a member of the SIPA1 family of RapGAPs. Little is known of the role of the SIPA1L2 protein, but recent studies of SIPA indicate that its deregulation can cause myeloproliferative stem cell disorders in mice and increased metastases in human cancers. Other studies suggest SIPA1L1 may play important roles in embryo development and control of cell proliferation. Based on the amount of homology between SIPA family members, it is likely that SIPA1L2 plays a role in embryo development and cell proliferation, possibly including oncogenesis.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q12872
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6433
Name Human SFRS8 (aa 200-290) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1190005N23Rik; 6330437E22Rik; AI197402; AW212079; serine/arginine-rich splicing factor 8; Sfrs8; SFSWAP; splicing factor SWAP homolog; splicing factor, arginine/serine-rich 8; splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot homolog, Drosophila); splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot, Drosophila homolog); splicing factor, suppressor of white-apricot family; splicing factor, suppressor of white-apricot homolog; splicing factor, suppressor of white-apricot homolog (Drosophila); Srsf8; Suppressor of white apricot protein homolog; SWAP
Common Name SFRS8
Gene Symbol SFSWAP
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSGVSSDNEDDDD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.