missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30202617

Invitrogen™ Human SPINK1 (aa 24-74) Control Fragment Recombinant Protein

Product Code. 30202617
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30202617

Brand: Invitrogen™ RP95135

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55634 (PA5-55634. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This is a trypsin inhibitor, its physiological function is to prevent the trypsin-catalyzed premature activation of zymogens within the pancreas. Defects in SPINK1 are a cause of pancreatitis (PCTT) [MIM:167800]. A disease characterized by the presence of calculi in pancreatic ducts. It causes severe abdominal pain attacks. Defects in SPINK1 are the cause of susceptibility to tropical calcific pancreatitis (TCP) [MIM:608189]. TCP is an idiopathic, juvenile, nonalcoholic form of chronic pancreatitis widely prevalent in several tropical countries. It can be associated with fibrocalculous pancreatic diabetes (FCPD) depending on both environmental and genetic factors. TCP differs from alcoholic pancreatitis by a much younger age of onset, pancreatic calcification, a high incidence of insulin dependent but ketosis resistant diabetes mellitus, and an exceptionally high incidence of pancreatic cancer.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P00995
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6690
Name Human SPINK1 (aa 24-74) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias calcium transport inhibitor; Caltrin; ISK1; P12; Pancreatic secretory trypsin inhibitor; pancreatic secretory trypsin inhibitor II; pancreatic secretory trypsin inhibitor type II (PSTI-II); PCTT; prostatic secretory glycoprotein; PSTI; PSTI-II; serine peptidase inhibitor Kazal type 1; serine peptidase inhibitor, Kazal type 1; serine peptidase inhibitor, Kazal type 3; serine protease inhibitor Kazal-type 1; Serine protease inhibitor Kazal-type 1-like; Serine protease inhibitor Kazal-type 3; serine protease inhibitor, Kazal type 1; serine protease inhibitor, Kazal type 3; Spink 3; Spink1; Spink1l; Spink3; TATI; TCP; Tumor-associated trypsin inhibitor
Common Name SPINK1
Gene Symbol SPINK1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.