missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30200959

Invitrogen™ Human TAF5 (aa 172-300) Control Fragment Recombinant Protein

Product Code. 30200959
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30200959

Brand: Invitrogen™ RP89362

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52266 (PA5-52266. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TFIID is a general transcription factor which initiates preinitiation complex assembly through direct interaction with the TATA promoter element. It is a multisubunit complex consisting of a small TATA-binding polypeptide andother TATA-binding protein (TBP)-associated factors (TAFs). Although native TFIID can mediate both activator-independent (basal) and activator-dependent transcription in reconstituted systems, TBP can mediate only basal transcription. TAF II p100 (TBP-associated factor II100), also known as TAF5 or TAFII100, is the third largest subunit of human TFIID. It contains six WD40 repeats at the C-terminus and has an N-terminus capable of forming a flexible dimer. TAF II p100 plays an important role in forming the scaffold that is crucial for the assembly of the TFIID complex. TAF II p100 may also be involved in the stabilization of TAF interactions.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q15542
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6877
Name Human TAF5 (aa 172-300) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6330528C20Rik; AV117817; TAF(II)100; TAF2D; TAF5; TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor; TAF5 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 100 kDa; TAFII100; TAFII-100; TATA box binding protein (TBP)-associated factor 2 D; TATA box binding protein (TBP)-associated factor, RNA polymerase II, D, 100 kD; TATA box binding protein associated factor 5; TATA-box binding protein associated factor 5; Tbp-associated factor 5; transcription initiation factor TFIID 100 kD subunit; transcription initiation factor TFIID 100 kDa subunit; Transcription initiation factor TFIID subunit 5
Common Name TAF5
Gene Symbol TAF5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TVVSGSASGPAAPGKVGSVAVEDQPDVSAVLSAYNQQGDPTMYEEYYSGLKHFIECSLDCHRAELSQLFYPLFVHMYLELVYNQHENEAKSFFEKFHGDQECYYQDDLRVLSSLTKKEHMKGNETMLDF
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.