missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30213006

Invitrogen™ Human TAF5L (aa 152-254) Control Fragment Recombinant Protein

Product Code. 30213006
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30213006

Brand: Invitrogen™ RP105441

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66966 (PA5-66966. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAF5L (TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L), also known as PAF65B, is a 589 amino acid protein that localizes to the nucleus and contains six WD repeats. Existing as a component of the PCAF histone acetylase complex, TAF5L interacts with a number of TAFs and, via this interaction, plays a role in histone acetylation and transcription initiation. Defects in the gene encoding TAF5L, which is expressed as multiple alternatively spliced isoforms, are associated with the pathogenesis of type I diabetes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75529
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27097
Name Human TAF5L (aa 152-254) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110005N04Rik; AI849020; Paf65b; PAF65-beta; PCAF associated factor 65 beta; PCAF-associated factor 65 beta; TAF5L; TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5 L; TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor; TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65 kDa; TATA box binding protein associated factor 5 like; TATA-box binding protein associated factor 5 like
Common Name TAF5L
Gene Symbol Taf5l
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.