missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TPSB2 (aa 178-207) Control Fragment Recombinant Protein

Product Code. 30194561
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194561

Brand: Invitrogen™ RP100365

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (70%), Rat (70%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61897 (PA5-61897. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TPSB2 is a protein coding gene. Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. These genes are characterized by several distinct features. They have a highly conserved 3' UTR and contain tandem repeat sequences at the 5' flank and 3' UTR which are thought to play a role in regulation of the mRNA stability. These genes have an intron immediately upstream of the initiator Met codon, which separates the site of transcription initiation from protein coding sequence. This feature is characteristic of tryptases but is unusual in other genes. The alleles of this gene exhibit an unusual amount of sequence variation, such that the alleles were once thought to represent two separate genes, beta II and beta III. Beta tryptases appear to be the main isoenzymes expressed in mast cells, whereas in basophils, alpha-tryptases predominate. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P20231
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64499
Name Human TPSB2 (aa 178-207) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AV011504; EC 3.4.21; EC 3.4.21.59; mast cell protease 6; mast cell tryptase beta II; mast cell tryptase beta III; Mcp6; Mcp-6; Mcpt6; MMCP-6; rMCP-6; testicular tissue protein Li 163; TPS2; TPS2tryptase beta-2; Tpsb2; tryptase beta 2; tryptase beta 2 (gene/pseudogene); tryptase beta II; tryptase beta III; tryptase beta-2; Tryptase II; tryptase III; Tryptase-2; tryptaseB; tryptaseC; Tryptase-C
Common Name TPSB2
Gene Symbol Tpsb2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence VKVPIMENHICDAKYHLGAYTGDDVRIVRD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.