missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30195932

Invitrogen™ Human Zap-70 (aa 246-385) Control Fragment Recombinant Protein

Product Code. 30195932
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30195932

Brand: Invitrogen™ RP95380

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82063 (PA5-82063. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZAP-70 is a cytosolic protein tyrosine kinase that is a member of the Syk family of proteins. ZAP-70 is expressed exclusively in T-cells and natural killer cells and is required for T-cell receptor activation. Upon T cell antigen receptor (TCR) engagement, ZAP70 is phosphorylated on tyrosines 292, 315 and 319 in the interdomain B, located between the SH2 and kinase domains. Phosphorylation of both tyrosines 315 (a Vav binding site) and 319 (a Lck binding site) enhances ZAP70 function in mediating lymphocyte signaling, while tyrosine 292 terminates the transient activation of ZAP70 and attentuates lymphocyte signaling.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P43403
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 7535
Name Human Zap-70 (aa 246-385) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 70 kDa zeta-associated protein; 70 kDa zeta-chain associated protein; ADMIO2; EC 2.7.10.2; FLJ17670; FLJ17679; I79_004087; IMD48; kinase ZAP70; mrtle; mur; Selective T cell defect; Srk; STCD; STD; syk-related protein tyrosine kinase; syk-related tyrosine kinase; Tyrosine-protein kinase ZAP-70; Tyrosine-protein kinase ZAP-70;TZK; TZK; ZA70; Zap70; ZAP-70; Zeta chain associated protein kinase 70 kDa; zeta chain of T cell receptor associated protein kinase; zeta chain of T cell receptor associated protein kinase 70; zeta chain of T cell receptor associated protein kinase 70 kDa; zeta-chain (TCR) associated protein kinase; zeta-chain (TCR) associated protein kinase 70; zeta-chain (TCR) associated protein kinase 70 kDa; zeta-chain associated protein kinase 70 kDa; zeta-chain associated protein kinase, 70 kD
Common Name Zap-70
Gene Symbol ZAP70
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence LIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARITSPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMRKKQIDVAIKVLKQGTEKADTEEMMR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.