missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. PCDHA10 Antibody - Azide and BSA Free, R&D Systems™

PCDHA10 Antibody - Azide and BSA Free, R&D Systems™

Code produit 18603770 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.02 mL
0.1 mL
Conditionnement:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
18603770 0.1 mL 0.10mL
18608421 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18603770 Fournisseur Novus Biologicals Code fournisseur NBP2931550.1ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Voir les produits de remplacement

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Descripción

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

PCDHA10 Polyclonal antibody specifically detects PCDHA10 in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Especificaciones

Antigène PCDHA10
Applications Western Blot
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 1:500-1:2000
Formule PBS (pH 7.3), 50% glycerol
Alias de gène CNR8, CNRN8, CNRS8, CRNR8, KIAA0345-like 4, ortholog to mouse CNR8, PCDH-alpha-10, PCDH-ALPHA10, protocadherin alpha 10, protocadherin alpha-10
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human PCDHA10 (NP_114066.1). PRFSVTEQKLSIPESRLLDSRFPLEGASDADVGENALLTYKLSPNEYFVLDIINKKDKDKFPVLVLRKLLDREENPQLKLL
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Cell Biology, Cell Cycle and Replication, Cytoskeleton Markers, Neuroscience, Signal Transduction
Primaire ou secondaire Primary
Identification génétique (Entrez) 56139
Espèces cibles Human
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Type de produit Antibody
Forme Purified
Isotype IgG
Gamme de produits Novus
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.