missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ MAD2L1 (Human) Recombinant Protein
Human MAD2L1 full-length ORF ( AAH00356, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00004085-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRSFTTTIHKVNSMVAYKIPVND
Specifications
| AAH00356 | |
| MAD2 mitotic arrest deficient-like 1 (yeast) | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MAD2L1 | |
| GST |
| 4085 | |
| Wheat germ expression system | |
| 25 μg | |
| HSMAD2, MAD2 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |