missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ NCKAP5 Recombinant Protein Antigen

Product Code. 18235234 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
Product Code. Quantity unitSize
18235234 100 μL 100µL
1 options
This item is not returnable. View return policy

Product Code. 18235234

Brand: Novus Biologicals™ NBP255168PEP

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCKAP5. Source: E.coli Amino Acid Sequence: PELQCETENELIKDTKSADNPDGGLQSKNNRRTPQDIYNQLKIEPRNRHSPVACSTKDTFMTELLNRVDKKAAPQTESGSSNASCRNVLKGSSQ The NCKAP5 Recombinant Protein Antigen is derived from E. coli. The NCKAP5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Specifications

Gene ID (Entrez) 344148
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name NCKAP5 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles
Formulation PBS and 1M Urea, pH 7.4
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias ERIH, ERIH1, ERIH2, FLJ34870, NAP5, NAP-5, Nck associated protein 5, NCK-associated protein 5, peripheral clock protein 2
Gene Symbol NCKAP5
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51456. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Show More Show Less

For research use only.

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.