missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ PMM2/Phosphomannomutase 2 Protein

Product Code. 18234595 Shop All Bio Techne Products
Click to view available options
Quantity:
0.1 mg
0.5 mg
Unit Size:
0.1mg
0.5mg
This item is not returnable. View return policy

Product Code. 18234595

Brand: Novus Biologicals™ NBP1486000.1MG

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-246 of Human PMM2/Phosphomannomutase 2 The Recombinant Human PMM2/Phosphomannomutase 2 Protein is derived from E. coli. The Recombinant Human PMM2/Phosphomannomutase 2 Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Concentration 1mg/mL
For Use With (Application) ELISA, SDS-PAGE
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 1mM DTT, 0.1M NaCl.
Gene ID (Entrez) 5373
Molecular Weight (g/mol) 30.2kDa
Purification Method Protein
Quantity 0.1 mg
Source Human
Immunogen PMM2, 1-246 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAAPGPALCLFDVDGTLTAPRQKITKEMDDFLQKLRQKIKIGVVGGSDFEKVQEQLGNDVVEKYDYVFPENGLVAYKDGKLLCRQNIQSHLGEALIQDLINYCLSYIAKIKLPKKRGTFIEFRNGMLNVSPIGRSCSQEERIEFYELDKKENIRQKFVADLRKEFAGKGLTFSIGGQISFDVFPDGWDKRYCLRHVENDGYKTIYFFGDKTMPGGNDHEIFTDPRTMGYSVTAPEDTRRICELLFS
Storage Requirements Store at -80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Common Name PMM2/Phosphomannomutase 2
Conjugate Unconjugated
Purity or Quality Grade >95%
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.