missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-1 gp41 Long Protein

A cDNA sequence encoding the HIV-1 gp41 Long was constructed and used to recombinantly synthesize the protein.

Brand:  enQuireBio™ QP12250-EC-500ug

Additional Details : Weight : 0.01000kg

 View more versions of this product

Product Code. 15979828

  • 757.92€ / 500µg


Estimated Shipment
26-03-2021
Add to basket

Description

Description

Specifications

Specifications

HIV-1 gp41 Long Protein
500 μg
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
HIV
Untagged
8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.
Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.
Research Use Only
Recombinant Protein
E. coli
IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL
Videos
SDS
Documents