missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant HSV HSV-2 gB Protein
A cDNA sequence encoding the HSV-2 gB was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12342-100ug
Additional Details : Weight : 0.01000kg
Specifications
| HSV HSV-2 gB Protein | |
| 100 μg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| HSV | |
| His | |
| 10mM Phosphate buffer pH 7.6 and 75mM NaCl. |
| Protein is >90% pure as determined by SDS PAGE. | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH |