missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 18201422

Novus Biologicals™ Recombinant Human alpha-Synuclein Protein

Product Code. 18201422 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18201422 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18201422 Brand Novus Biologicals™ Brand No. NBC118331

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Highly purified. Generating reliable and reproducible results.

An un-tagged recombinant protein corresponding to the amino acids 1-140 of Human alpha-Synuclein The Recombinant Human alpha-Synuclein Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number NP_000336.1
For Use With (Application) ELISA, SDS-PAGE
Formulation 20mM Tris-HCl buffer (pH 7.5), 0.1 M NaCl
Gene ID (Entrez) 6622
Molecular Weight (g/mol) 14.4kDa
Name Synuclein-alpha Protein
Purification Method Protein
Quantity 0.1 mg
Source E. Coli
Immunogen MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKKGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Storage Requirements −80°C. Avoid freeze-thaw cycles.
Regulatory Status RUO
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Research Category Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience
Purity or Quality Grade >95%, by SDS-PAGE
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.