missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. enQuireBio™ Recombinant Human FSH Protein

enQuireBio™ Recombinant Human FSH Protein

Product Code. 15934438
Click to view available options
Quantity:
1 mg
10 μg
2 μg
Unit Size:
10µg
1mg
2µg
This item is not returnable. View return policy

Product Code. 15934438

Brand: enQuireBio™ QP106202ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

A cDNA sequence encoding the FSH was constructed and used to recombinantly synthesize the protein.

Specifications

Name FSH Protein
Quantity 2 μg
Regulatory Status Research Use Only
Endotoxin Concentration < 1.0 EU per ug protein as determined by the LAL method.
Biological Activity The ED50 as determined by cAMP accumulation in human FSH Receptor transfected Chinese Hamster Ovary cells was found to be 80-450 pg/ml.
Product Type Recombinant Protein
Cross Reactivity Human
Species Human (HEK293)
Protein Tag Untagged
Sequence FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKSFSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE
Buffer The recombinant FSH was lyophilized from a concentrated (1 mg/ml) solution containing PBS.
Purity or Quality Grade Greater than 95% as determined by SDS-PAGE.
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.