missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human LR3 IGF1 Protein
A cDNA sequence encoding the LR3 IGF1 was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP10775-1mg
Additional Details : Weight : 0.01000kg
Specifications
| LR3 IGF1 Protein | |
| Research Use Only | |
| The ED50 as determined by the stimulation of protein synthesis in L6 myoblasts is less than 10ng/ml, corresponding to a specific activity of 100,000units/mg. | |
| Human | |
| Untagged | |
| Lyophilized from a 0.2microm filtered concentrated solution in 1xPBS. |
| 1 mg | |
| < 1.0 EU per ug protein as determined by the LAL method. | |
| Recombinant Protein | |
| E. coli | |
| MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA | |
| Greater than 95.0% as determined by SDS-PAGE and HPLC. |