missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human p16-INK4a Protein

Name: enQuireBio&trade; Recombinant Human p16-INK4a Protein
Brand: enQuireBio&trade;
SKU: 15922039
Price: 212.00 EUR

A cDNA sequence encoding the p16-INK4a was constructed and used to recombinantly synthesize the protein.

Brand: enQuireBio™ QP12946-20ug

Additional Details : Weight : 0.01000kg

Product Code. 15922039

Estimated Shipment: 28-06-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Specifications

Gene ID (Entrez)	1029
Quantity	20 μg
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type	Recombinant Protein
Species	E. coli
Sequence	MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Purity or Quality Grade	Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Name	p16-INK4a Protein
Regulatory Status	Research Use Only
Gene Symbol	CDKN2A
Cross Reactivity	Human
Protein Tag	Untagged
Buffer	CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4.

Product Suggestions

Description