missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Human p16-INK4a Protein

Product Code. 15932039
Click to view available options
Quantity:
1 mg
20 μg
5 μg
Unit Size:
1mg
20µg
5µg
This item is not returnable. View return policy

Product Code. 15932039

Brand: enQuireBio™ QP12946EC1mg

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

A cDNA sequence encoding the p16-INK4a was constructed and used to recombinantly synthesize the protein.

Specifications

Gene ID (Entrez) 1029
Name p16-INK4a Protein
Quantity 1 mg
Regulatory Status Research Use Only
Endotoxin Concentration Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Gene Symbol CDKN2A
Product Type Recombinant Protein
Cross Reactivity Human
Species E. coli
Protein Tag Untagged
Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Buffer CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4.
Purity or Quality Grade Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.