missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human p16-INK4a Protein
A cDNA sequence encoding the p16-INK4a was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12946-20ug
Additional Details : Weight : 0.01000kg
Specifications
| 1029 | |
| Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE. | |
| Research Use Only | |
| CDKN2A | |
| Human | |
| Untagged | |
| CDKN2A was lyophilized from a concentrated (1 mg/ml) sterile solution containing 1x PBS pH 7.4. |
| p16-INK4a Protein | |
| 20 μg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Recombinant Protein | |
| E. coli | |
| MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |