missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rainbow Trout GH Protein
A cDNA sequence encoding the GH was constructed and used to recombinantly synthesize the protein.
137.00€ - 5450.00€
Specifications
Name | GH Protein |
---|---|
Regulatory Status | Research Use Only |
Endotoxin Concentration | < 1.0 EU per ug protein as determined by the LAL method. |
Biological Activity | Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH. |
Product Type | Recombinant Protein |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
15934468
|
enQuireBio™
QP10630-2UG |
2 μg |
137.00€
2µg |
Estimated Shipment: 24-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15914468
|
enQuireBio™
QP10630-10UG |
10 μg |
212.00€
10µg |
Estimated Shipment: 24-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
15924468
|
enQuireBio™
QP10630-1MG |
1 mg |
5450.00€
1mg |
Estimated Shipment: 24-06-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Specifications
GH Protein | |
< 1.0 EU per ug protein as determined by the LAL method. | |
Recombinant Protein | |
E. coli | |
AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL | |
Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. |
Research Use Only | |
Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH. | |
Rainbow Trout | |
Untagged | |
The protein was lyophilized from a concentrated (1 mg/ml) solution with 0.5% NaHCO3. Adjusted to pH 8. |