missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rat CNTF Protein
A cDNA sequence encoding the CNTF was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP10559-25ug
Additional Details : Weight : 0.01000kg
Specifications
| CNTF Protein | |
| 25 μg | |
| < 1.0 EU per ug protein as determined by the LAL method. | |
| Recombinant Protein | |
| E. coli | |
| AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM |
| Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE. | |
| Research Use Only | |
| Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. | |
| Rat | |
| Untagged | |
| Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3. |