missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant Rat CNTF Protein

Product Code. 15934248
Click to view available options
Quantity:
1 mg
25 μg
5 μg
Unit Size:
1mg
25µg
5µg
This item is not returnable. View return policy

Product Code. 15934248

Brand: enQuireBio™ QP105595ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

A cDNA sequence encoding the CNTF was constructed and used to recombinantly synthesize the protein.

Specifications

Name CNTF Protein
Quantity 5 μg
Regulatory Status Research Use Only
Endotoxin Concentration < 1.0 EU per ug protein as determined by the LAL method.
Biological Activity Fully biologically active by its ability to phosphorylate STAT3 in several cells lines.
Product Type Recombinant Protein
Cross Reactivity Rat
Species E. coli
Protein Tag Untagged
Sequence AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM
Buffer Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3.
Purity or Quality Grade Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE.
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.