missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant West Nile Virus WNV Pre-M Protein

Product Code. 15955259
Click to view available options
Quantity:
1 mg
100 μg
500 μg
Unit Size:
100µg
1mg
500µg
This item is not returnable. View return policy

Product Code. 15955259

Brand: enQuireBio™ QP13965100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

A cDNA sequence encoding the WNV Pre-M was constructed and used to recombinantly synthesize the protein.

Specifications

Name West Nile Virus WNV Pre-M Protein
Quantity 100 μg
Regulatory Status Research Use Only
Endotoxin Concentration Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type Recombinant Protein
Cross Reactivity West Nile Virus
Species E. coli
Protein Tag His
Sequence MVTLSNFQGKVMMTVNATDVTDVITIPTAAGKNLCIVRA MDVGYLCEDTITYECPVLAAGNDPEDIDCWCTKSSVYVRYGRCTKTRHSRRSRRSLTVQTHGESTLANKKGAWLDSTKATRYLVKTESWILRNPGYALE
Buffer 20mM phosphate buffer pH 7.5.
Purity or Quality Grade Protein is >95% pure as determined by SDS-PAGE.
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.