missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. S100P Antibody, R&D Systems™

S100P Antibody, R&D Systems™

Code produit 18222828 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
25 μL
0.1 mL
Conditionnement:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
18222828 0.1 mL 0.10mL
18403391 25 μL 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18222828 Fournisseur Novus Biologicals Code fournisseur NBP189541
 Article restreint
Estimated Shipment: 01-12-2026
Zum Warenkorb hinzufügen
Zum Warenkorb hinzufügen

missing translation for 'validMainframeMsg'

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

S100P Polyclonal specifically detects S100P in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).
TRUSTED_SUSTAINABILITY

Spezifikation

Antigène S100P
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugué Unconjugated
Dilution Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formule PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Alias de gène MIG9, migration-inducing gene 9, Protein S100-E, S100 calcium binding protein P, S100 calcium-binding protein Pprotein S100-P, S100E
Symboles de gène(s) S100P
Espèces hôtes Rabbit
Immunogène This antibody was developed against Recombinant Protein corresponding to amino acids:MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEF
Méthode de purification Affinity Purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Cancer
Primaire ou secondaire Primary
Identification génétique (Entrez) 6286
Spécificité du test Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Espèces cibles Human
Contenu et stockage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Type de produit Antibody
Isotype IgG
Gamme de produits Novus
Mehr anzeigen Weniger anzeigen

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.