missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. SC65 Antibody - Azide and BSA Free, R&D Systems™

SC65 Antibody - Azide and BSA Free, R&D Systems™

Code produit 18611711 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.02 mL
0.1 mL
Conditionnement:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
18611711 0.1 mL 0.10mL
18678260 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18611711 Fournisseur Novus Biologicals Code fournisseur NBP2946400.1ml

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 Voir les produits de remplacement

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SC65 Polyclonal antibody specifically detects SC65 in Human, Rat samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Spécification

Antigène SC65
Applications Western Blot
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 1:500-1:2000
Formule PBS (pH 7.3), 50% glycerol
Alias de gène leprecan-like 4, Leprecan-like protein 4, NO55, 55kDa, NOL55, Nucleolar autoantigen No55, SC65rat synaptonemal complex protein, synaptonemal complex protein SC65
Espèces hôtes Rabbit
Immunogène Recombinant fusion protein containing a sequence corresponding to amino acids 338-437 of human P3H4 (NP_006446.1). FHRARWGLEEEDFQPREEAMLYHNQTAELRELLEFTHMYLQSDDEMELEETEPPLEPEDALSDAEFEGEGDYEEGMYADWWQEPDAKGDEAEAEPEPELA
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Cell Cycle and Replication
Primaire ou secondaire Primary
Identification génétique (Entrez) 10609
Espèces cibles Human, Rat
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Type de produit Antibody
Forme Purified
Isotype IgG
Gamme de produits Novus
Afficher plus Afficher moins
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.