missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Anticorps
  4. Anticorps primaires
  5. Tous les anticorps primaires
  6. SLC25A43 Antibody - Azide and BSA Free, R&D Systems™

SLC25A43 Antibody - Azide and BSA Free, R&D Systems™

Code produit 18604952 Tous les produits Bio Techne Produits
Modifier l'affichage
Click to view available options
Quantité:
0.02 mL
0.1 mL
Conditionnement:
0.02mL
0.10mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantité Conditionnement
18604952 0.1 mL 0.10mL
18606302 0.02 mL 0.02mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18604952 Fournisseur Novus Biologicals Code fournisseur NBP2942090.1ml
 Article restreint
Estimated Shipment: 04-12-2026
Ajouter au panier
Ajouter au panier

missing translation for 'validMainframeMsg'

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

A Novus product, part of R&D Systems. Rabbit Polyclonal Antibody

SLC25A43 Polyclonal specifically detects SLC25A43 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigène SLC25A43
Applications Western Blot
Classification Polyclonal
Conjugué Unconjugated
Dilution Western Blot 1:500 - 1:1000
Formule PBS (pH 7.3), 50% glycerol
Alias de gène solute carrier family 25 member 43, solute carrier family 25, member 43
Espèces hôtes Rabbit
Immunogène A synthetic peptide corresponding to a sequence within amino acids 1-100 of human slc25a43 (NP_660348.2). MATWRRDGRLTGGQRLLCAGLAGTLSLSLTAPLELATVLAQVGVVRGHARGPWATGHRVWRAEGLRALWKGNAVACLRLFPCSAVQLAAYRKFVVLFTDD
Méthode de purification Affinity purified
Quantité 0.1 mL
État réglementaire RUO
Disciplines de recherche Endocrinology, Signal Transduction
Primaire ou secondaire Primary
Identification génétique (Entrez) 203427
Espèces cibles Human
Contenu et stockage Store at -20°C. Avoid freeze-thaw cycles.
Type de produit Antibody
Forme Purified
Isotype IgG
Gamme de produits Novus
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.